PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004491903.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 250aa    MW: 28886.7 Da    PI: 9.2599
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004491903.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.41.5e-31959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  XP_004491903.1  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCS 59
                    79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.417161IPR002100Transcription factor, MADS-box
SMARTSM004325.6E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.26E-33277IPR002100Transcription factor, MADS-box
CDDcd002652.96E-44276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-32323IPR002100Transcription factor, MADS-box
PfamPF003193.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-323859IPR002100Transcription factor, MADS-box
PfamPF014862.2E-2788172IPR002487Transcription factor, K-box
PROSITE profilePS5129715.26688178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0048481Biological Processplant ovule development
GO:0071486Biological Processcellular response to high light intensity
GO:0071492Biological Processcellular response to UV-A
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFST RGKLYEFCST  60
SNMLKTLDRY QKCSYGAVEV SKPAKELEQS SYREYLKLKQ RFENLQKTQR NLLGEDLGPL  120
NSKDLEQLER QLDSSLKQVR STKTQFMLDQ LADLQNKEHM LVEANRSLSI KLDEINSRNH  180
YRQSWEAGDQ SMQYGGPQNA HSQSFFQQLE CNPTLQIGPD YRYNNVTSDQ IASTSQAQQQ  240
VNGFVPGWML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A3e-37751721101Developmental protein SEPALLATA 3
4ox0_B3e-37751721101Developmental protein SEPALLATA 3
4ox0_C3e-37751721101Developmental protein SEPALLATA 3
4ox0_D3e-37751721101Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX3907170.0JX390717.1 Medicago polyceratia SEPALLATA1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004491903.10.0PREDICTED: developmental protein SEPALLATA 1 isoform X1
SwissprotP293841e-129SEP2_ARATH; Developmental protein SEPALLATA 2
TrEMBLK4JR451e-178K4JR45_9FABA; SEPALLATA1
STRINGGLYMA13G06730.11e-160(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22932178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02310.11e-131MIKC_MADS family protein